DPCstruct | MC53411
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 149 ± 18 aa |
| Standard deviation of domain lengths | 18.09 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 32.54 |
| Pfam Score | 59.03 |
| Assigned Pfam label(s) | CL0023- CL0671- PF04577 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A8Z9K8 | 2-129 | VSSDDNTEFMIDMLRECVLAHKTIIFVLEEFDLFAQGKQRLLYSLLDAMQSLTSQAVVIGVSCRLDADKLLEKRVKSRFSHRKLLFV… |
| A0A397B007 | 213-358 | SFFNMYDLLKQLLLQKALQEHAVIFILDAFDAFVMDAKQLLVYNLLDWMQSKDVRVALVGISCNFNVLAQFEKRVKSRFSNIQVVVP… |
| A0A4T0TI42 | 145-296 | None |
| A0A6S7MIR3 | 888-1043 | None |
| T1GZN8 | 68-192 | None |
| A0A498NKL2 | 427-555 | None |
| A0A4Y7JLB0 | 115-240 | None |
| A0A7S2R0Q2 | 31-210 | None |
| A0A3B4ZMB8 | 62-210 | None |
| A0A1J9P6T6 | 410-571 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.