DPCstruct | MC5341
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 74 ± 6 aa |
| Standard deviation of domain lengths | 6.37 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 59.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287GHB0 | 85-157 | YGREEEADTLIEQMIRDQDPILRYGGMYALALAYRGTANNKAIHQLLHFAVSDVSDDVRRTAVMGLGFVLYNE |
| K7DZZ0 | 891-963 | YGRMEEADALIESLCRDKDPILRRSGMYTVAMAYCGSGNNRAIRRLLHVAVSDVNDDVRRAAVESLGFILFRT |
| A0A0L7R3J3 | 1-73 | None |
| A0A830CGF2 | 358-419 | None |
| B9RWJ0 | 572-644 | None |
| A0A146LWI8 | 4-73 | None |
| R4XB38 | 534-606 | None |
| A0A3P7LIQ1 | 167-238 | None |
| A0A812S8Z6 | 29-101 | None |
| U7Q0J1 | 667-739 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.