DPCstruct | MC53409
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 326 ± 39 aa |
| Standard deviation of domain lengths | 39.27 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 72.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 34.56 |
| Pfam Score | 96.15 |
| Assigned Pfam label(s) | PF07891- PF01199 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D6MM37 | 353-683 | SVEWQSSTVTKDSETEYPFSCSSRRSSARWEPYTLFRKYDEDMVYFHRVGAQKLTETESFRSIKYQPRSVSERIVHKLTPSWPSTRI… |
| A0A0A8YTG7 | 2-266 | VYLHRVGAQKLTETESFRSIKYQPRSMSDRIVHKLTPKPSAPIGLRDPYPDLERAYVAQVCLTWEALNWNYTSFRRHNGGDGNIAAR… |
| A0A2P5AAB7 | 391-730 | None |
| A0A6I9S3K0 | 925-1279 | None |
| A0A540LX55 | 132-409 | None |
| A0A022R200 | 197-521 | None |
| A0A1R3IIP5 | 1-350 | None |
| A0A4P1RK62 | 965-1254 | None |
| A0A166B4A2 | 142-488 | None |
| A0A7J7M023 | 556-902 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.