DPCstruct | MC53408
Metacluster Properties and Pfam Annotations
| Number of structural domains | 264 |
|---|---|
| Mean domain length (aa) | 121 ± 28 aa |
| Standard deviation of domain lengths | 28.44 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 86.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 21.89 |
| Pfam Score | 99.53 |
| Assigned Pfam label(s) | CL0126- CL0546 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E5YHA6 | 4-124 | QTKQQLMARLERDALRICARFRLSYRALEPERANVKRRYGVCFSDGTIRIRLIHVTTKRPLKYSSLVNTLCHELAHLRHFNHGPRFQ… |
| A0A3D5TG51 | 72-167 | ALRQRARHVLPPMVKLWAQRMGVTPTGVKITAAKTRFGSCSGKDSLCFSLHLMEYPLEAAEAVVVHELAHIRHKNHGPDFYALVRRT… |
| A0A5M8P6I3 | 163-261 | None |
| A0A2V7Y420 | 1-174 | None |
| A0A1V8SNM3 | 285-425 | None |
| A0A061REN7 | 12-140 | None |
| A0A1W9L9L0 | 127-234 | None |
| A0A365MVC2 | 259-410 | None |
| A0A1F9H5Z1 | 6-158 | None |
| A0A2V7W769 | 6-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.