DPCstruct | MC53405
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 76 ± 10 aa |
| Standard deviation of domain lengths | 10.21 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 33.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E3NJ85 | 6-83 | RLLDILCCPETRQPVARAEASVLQPLNAEIEAGRLRNRGGDKIEARIEEGLLREDGRVLYIVDDSIPIMLIGESIELG |
| A0A2E6E7W2 | 1-59 | MLASVNKAIQKGSLTNRDGVLLDKPLTAALVTDDGKLLYPISDGIPVLLEGESITLEQI |
| A0A518AUS1 | 1-60 | None |
| A0A7C5LYW1 | 4-82 | None |
| A0A2E7ZQD1 | 9-87 | None |
| A0A2A2XUL7 | 1-72 | None |
| A0A351FTJ6 | 10-89 | None |
| A0A1I0QFL8 | 8-81 | None |
| B9XST1 | 132-210 | None |
| A0A286RGZ4 | 2-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.