DPCstruct | MC53404
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 181 ± 25 aa |
| Standard deviation of domain lengths | 24.64 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 76.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 26.71 |
| Pfam Score | 97.22 |
| Assigned Pfam label(s) | CL0020- PF19311- PF19314 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B5DFN7 | 248-379 | FFEGHFLKVLFDRMGRILDQPYDVNLQVTSVLSKLSLFPHPHIHEFLLDPYVNLAPGCRSLFSVIVRVVGDLMVRIQRIPEFTPKLL… |
| A0A6G0HK47 | 1-187 | MMSSCKESSRGHGVPFTGPFISVLLSRLENLLENSIAVNLLVTGILAQLVSYPQPLLRSFLLSTDDHNQPNVRTLYQVLVSVRAQIE… |
| A0A1S3QRE0 | 58-237 | None |
| A0A7R8D2R5 | 648-825 | None |
| A0A0B2VF28 | 97-291 | None |
| S9X120 | 219-393 | None |
| A0A3B4V5A2 | 177-311 | None |
| T1HB05 | 939-1098 | None |
| A0A817D8Z5 | 435-658 | None |
| A0A0A9Y5N7 | 264-436 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.