DPCstruct | MC53402
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 76 ± 4 aa |
| Standard deviation of domain lengths | 4.20 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 31.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V6V4Y4 | 1-86 | MYFRVVVACGHIGCRREVEVTRYFEADSAIDAWESALMMPRVKKSQRSRAIRRVEQIDVMEYLWGKLAERENPYLQNKRVKADQII |
| A0A316APL1 | 9-84 | KMFEAVCKCGHVGKTHYVIIRFPLMAQSRKDAARIARQMPRVKHDHQDAILDVIKIDQKRYFELLEINNHDPYLHC |
| A0A097AR55 | 12-87 | None |
| A0A7C9HFW3 | 3-77 | None |
| A0A1F8YG05 | 1-78 | None |
| A0A3D5PDW7 | 3-78 | None |
| A0A3B9V7E4 | 36-111 | None |
| A0A357BQZ6 | 1-71 | None |
| A0A1F9DEQ3 | 18-93 | None |
| A0A143Z8C4 | 5-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.