DPCstruct | MC534
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 66 ± 5 aa |
| Standard deviation of domain lengths | 5.18 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 35.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X5DZZ6 | 5-65 | EKLTLTLLGRDSWSRPVYEGSDGNLYVDTDPCADRQPRICTKYRNAFNGEPDIPVHAEFTF |
| R9K152 | 9-75 | DTLELQPIGTDFWSRPVYKDQHGHLWKDITLGSNQPDLCSVVDNAFDGEPDMPIRRPFIILSKEGQA |
| A0A3A5ZQQ2 | 6-60 | None |
| U2QMN9 | 74-141 | None |
| A0A1C5PBD5 | 69-135 | None |
| A0A1Y4WCR3 | 83-143 | None |
| A0A7X3MHT9 | 154-223 | None |
| A0A1C6D5J9 | 31-100 | None |
| G1UWC2 | 3-76 | None |
| A0A564VBC0 | 96-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.