DPCstruct | MC53391
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 235 ± 32 aa |
| Standard deviation of domain lengths | 32.49 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 34.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A367JJL4 | 234-449 | VASTAFQFNPAIQPQAFVVLGCLGREEMDDDLLYQILVALRGALAIFNESDPNLVLSIMMCLKNIVESLPPDSRYLLSLFWVAVALV… |
| A0A1B0DLA3 | 152-373 | WTSLSKSFAFCYNPALQPRALIVYGCISKSVTDQDVKQLLRILPLLRPESPIHRALFWVAVSVLQLDEVTLYAAGLALLEQNLHTLN… |
| A0A1I8HUJ6 | 1-273 | None |
| A0A367KJV8 | 593-817 | None |
| A0A2Z6RAU9 | 4-210 | None |
| A0A063BRB3 | 320-546 | None |
| A0A1B5L6T0 | 4-208 | None |
| A0A3P7XIB7 | 1-303 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.