DPCstruct | MC5339
Metacluster Properties and Pfam Annotations
| Number of structural domains | 75 |
|---|---|
| Mean domain length (aa) | 155 ± 26 aa |
| Standard deviation of domain lengths | 26.11 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 25.62 |
| Pfam Score | 98.00 |
| Assigned Pfam label(s) | CL0276- CL0161 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B0DMC0 | 254-408 | MNATTFCKAFPWHFVMNENLELLQLGHGFNRLFRQSLSLYGRHATTYFRFKRPRGLSLNFQEIRKHTHTPFLLAIRSQVCRRDSTMT… |
| A0A0N4YJI7 | 244-403 | QFEAPTTDFRMSADDFCTAFPYHICFSTDLFIEHVGHFIRKAFPTINAKTNVCDIMEIVHPQVQFSYESVLAFKNSHFIFQLKQTAE… |
| A0A1Y1KXX0 | 89-254 | None |
| A0A3S9PAV4 | 12-154 | None |
| A0A0D8XEM2 | 16-144 | None |
| A0A7E4VSR2 | 36-197 | None |
| E9FT53 | 14-175 | None |
| A0A2C9JPJ7 | 43-229 | None |
| A0A4C1TMD2 | 113-290 | None |
| L8GLZ3 | 190-364 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.