DPCstruct | MC53388
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1894 |
|---|---|
| Mean domain length (aa) | 307 ± 79 aa |
| Standard deviation of domain lengths | 79.08 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 87.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 14.78 |
| Pfam Score | 93.09 |
| Assigned Pfam label(s) | PF00384- CL0608- CL0015- CL0177- CL0051 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A836D836 | 432-801 | LIIIGGGSGGLAAAKEAAKYDKKVMVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQALRDSRNYGWNVEETVKHDWERM… |
| A0A6P8IKJ7 | 76-417 | QLTLSLNNWLELPGLEFQDWLREHRHEAVRKPCTLVKNRIESPGNSYDRATTSHIAEYYKDYVDKMDLSGYFSNDSKVLSVKHGSDG… |
| A0A812NMD9 | 451-846 | None |
| A0A421JW65 | 45-488 | None |
| A0A445CWX7 | 2-212 | None |
| A0A2K3JFL5 | 194-483 | None |
| W6Y300 | 6-363 | None |
| A0A146HY12 | 201-711 | None |
| A0A146I571 | 735-1093 | None |
| A0A1I3NBW8 | 20-343 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.