DPCstruct | MC53384
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 169 ± 34 aa |
| Standard deviation of domain lengths | 34.48 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 84.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.44 |
| Pfam Score | 87.62 |
| Assigned Pfam label(s) | PF04039- PF20501 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A538M667 | 29-179 | MGVALLLREVRDPRARRNDRVSSDAVRLAGVGFAAGLFVLGLSVVAHGPITPGGGFQGGVVLASAFALVYLAGDYRSYRKLTPSFGI… |
| A0A1F4TRB2 | 2-121 | LLYGCYLISHGHLSPGGGFQGGVIFGSAIILLGLVEGIKEAENRFQEKALSLIKNIGMLVFLLMGFMSMFFGRAFLSDFMPRGEIGT… |
| A0A1Y4LSS9 | 126-340 | None |
| A0A6G2HFT0 | 44-202 | None |
| A0A4U5J818 | 25-177 | None |
| A0A1Q9V8U2 | 344-532 | None |
| A0A7J0CZL1 | 146-376 | None |
| A0A380FEE8 | 2-117 | None |
| A0A0P8W4B3 | 2-231 | None |
| A0A7C3DJ83 | 123-283 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.