DPCstruct | MC53381
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 122 ± 9 aa |
| Standard deviation of domain lengths | 8.82 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 33.23 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | CL0036- CL0244 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A561V6S0 | 98-209 | MESYDITDKACNDATLTYVRSFTKTLRNATYRGGLYGFSSSSAKAIATAPNKTDLPGNLWYALWDKRNTTTTDWPWNPAQYTDHSRG… |
| A0A4S8N002 | 401-523 | LEGWSNHKNATCRESSLSFLSGWTEKVRDLGYVSGVYSSAGSGMKILDDARAQRRKDVVLPDQIWIARWDLKANTSTSYLRADGWLP… |
| A0A7G6X2H1 | 269-396 | None |
| A0A3N0GS59 | 278-409 | None |
| A0A7J9YL89 | 164-288 | None |
| A0A4R4LKZ4 | 401-511 | None |
| A0A6J6QU84 | 159-284 | None |
| A0A7K2ND05 | 269-382 | None |
| A0A2G8T481 | 1-117 | None |
| A0A0Q9QV58 | 99-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.