DPCstruct | MC5338
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 135 ± 15 aa |
| Standard deviation of domain lengths | 15.08 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 44.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0030 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W0X2C0 | 113-277 | HRLQQEANKIVCCQNLIGEIIAVFGFLVAMTSFGIYAYEVSDVVPDLEICRAWLISVEWQIDFACNLFFLLYFVLRLAASNRKVWFL… |
| A0A1B0DMB1 | 4-140 | VFILSIASLIIYFIDASSEEVERCQTWSNNITQQIDLAFNIFFMVYFFIRFIAASDKLWFMLEMYSFVDYFTIPPSFVSIYLDRTWI… |
| A0A6G0ZNU6 | 37-175 | None |
| A0A267G2P5 | 4-121 | None |
| A0A368FMP8 | 1-129 | None |
| A0A183SKP5 | 6-127 | None |
| A0A183T4S4 | 296-421 | None |
| A0A6P8IZD3 | 91-253 | None |
| G3NC79 | 67-204 | None |
| A0A3P7EH98 | 2-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.