DPCstruct | MC53379
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 769 ± 84 aa |
| Standard deviation of domain lengths | 83.68 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 19.83 |
| Pfam Score | 80.28 |
| Assigned Pfam label(s) | CL0020- PF12807- PF13236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P6NGF0 | 125-832 | SQPSKSLPNNKRATIRDRDTLEDRNAAGNYVSMKDGYSTMYYDDAQHLPTQDQHNVDITSYPSGQTVKEKMMRVHNHDHHLSIVSPF… |
| A0A0K0E7J3 | 1006-1789 | FESTQDYFRSEDETQVQKTGFEDLFPGGLRDWNEELCNGKDMPKKDFRERLDKDRLFYKSYSDFVKVAVKGAMAIIDGNVPSLNMSD… |
| F4PVD2 | 78-774 | None |
| Q54ZA9 | 339-1250 | None |
| Q54YP3 | 247-1036 | None |
| H3HDX6 | 345-1095 | None |
| A0A7S4KEP2 | 1-706 | None |
| Q54T92 | 1186-2099 | None |
| L8GHQ3 | 328-1095 | None |
| L8GHN8 | 79-751 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.