DPCstruct | MC53377
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 392 ± 56 aa |
| Standard deviation of domain lengths | 56.45 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 75.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 27.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P6N2I3 | 23-438 | HSHTQIIDDQLSERFEKAVQALQTTRDGLDKDEVRSWLTQSIIRCGKEASRHQRRKKLEQLTEENPEIAYQLFILICREKSRLISKF… |
| A0A484MCC7 | 1-376 | MLQLFLSTPPLNENGDDKIAEQMRSHLKELESVIWSLISSGHRSEARLWLCKSVADIHSLTPHHKKELFLALLRSNTAKPQRLAAQI… |
| B9SEY7 | 4-382 | None |
| Q54W00 | 81-468 | None |
| A0A4Y1QXV6 | 1-306 | None |
| A0A0U9HKP4 | 10-458 | None |
| D3B185 | 75-557 | None |
| A0A6J1KWG9 | 1-379 | None |
| A0A250XBM9 | 5-397 | None |
| A0A444YW93 | 4-468 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.