DPCstruct | MC53370
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 331 ± 23 aa |
| Standard deviation of domain lengths | 23.28 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 79.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183KZE9 | 1-316 | LYFRLTYSIIGQCDLTENHSDIISNIDDFLWIKISQVIAQEPSESVVASKNSMDDTFTLGQLQTLLYETYGEVHFDAWSQPLVFFKI… |
| A0A2U3YPE2 | 204-496 | YKRAVYCIIGRCDITDNQSEVADKTEDYLWLKLNQVCFDDDGTSSPQDRLTLSQFQKQLLEDYGESHFTVNQQPFLYFQVLFLTAQF… |
| A0A314YSA5 | 364-691 | None |
| A0A7S1UKJ5 | 319-629 | None |
| A0A1J3H6Z2 | 1-367 | None |
| A0A1Y3NPY7 | 139-491 | None |
| A0A4D8XQP3 | 278-591 | None |
| A0A7S4S7U1 | 7-343 | None |
| A0A163JIQ8 | 395-759 | None |
| A0A444E649 | 34-355 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.