DPCstruct | MC5337
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 115 ± 18 aa |
| Standard deviation of domain lengths | 17.63 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 37.46 |
| Pfam Score | 98.84 |
| Assigned Pfam label(s) | CL0010- PF04981 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J4T7C3 | 4-128 | GGEFCLVCGSPPPLFGQRICEACFRERLQLVKIPKNINWSRCPRCQITKIDKSWVKVPDDWLWDELMQQNLHVHEDAKEISIGLHTQ… |
| A0A1B0DM35 | 5-110 | CLRTHVDITEGIPKQAVLQFCRNCERYLQPPSEWVQCSLESRELLAVCLKRLKGLKEVKLIDAGFIWTEPHSKRLKVKLTVQGEVLG… |
| A0A1V8SDU3 | 392-510 | None |
| A0A0V0QU82 | 21-154 | None |
| A0A835H0D1 | 1-82 | None |
| A0A835GVV0 | 69-176 | None |
| A0A7E5WAD0 | 4-114 | None |
| A0A7J6PIY8 | 22-148 | None |
| A0A0D2ZYC6 | 27-134 | None |
| A0A812UT38 | 1-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.