DPCstruct | MC53369
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 154 ± 27 aa |
| Standard deviation of domain lengths | 26.92 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 45.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183KZA1 | 57-189 | MPKTYPWSSDLQIFLNVYNGTLILHAEDSSVLRQCLAFFIQCCYQFKTVFATTGYSGIVPTLVRVYNQNTHNPVLTQAIEFTFRQFY… |
| A0A182EJT9 | 223-370 | DTMHKFVWTLLMSDMFQKMENAFMFGDLHLFINVINGVTLLHCENVTILRRCMATYLSMAIHFSTLFTNQGFFLIMPTILRCYSQRQ… |
| A0A817BMZ4 | 1-136 | None |
| A0A3P7CFD6 | 99-258 | None |
| A0A815V559 | 1-139 | None |
| A0A7J6CXI1 | 14-219 | None |
| A0A7J5Z6Y0 | 126-279 | None |
| A0A817NWN1 | 1-136 | None |
| A0A177B7Z4 | 470-616 | None |
| A0A4Z2CN94 | 63-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.