DPCstruct | MC53357
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 115 ± 9 aa |
| Standard deviation of domain lengths | 9.03 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 75.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 37.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S9Y2P3 | 1-114 | METTGETLKTTTPSKSPHLPWEHDFFIYNGVVDKTAPDFVAFKEHFSLSWGSIFSLLEHIQRFLRDYAIPEVKIKGNSLAALLPEFE… |
| A0A2Y9R1I9 | 4-107 | PTPSRATKVPWEFDFYIYNGIIDKTAPDFLAFKRHFNLAWGSIFSLLEHIEKFLKDYAIPEVKIKGNSLVALLPEFELKNRLTRYDL… |
| A0A4W5MG44 | 1-124 | None |
| A0A3Q3VNS2 | 64-167 | None |
| A0A3B4A669 | 38-162 | None |
| L9KIQ8 | 119-237 | None |
| A0A2P4TD90 | 3-122 | None |
| A0A556V6T1 | 90-192 | None |
| A0A834FRM1 | 1-107 | None |
| A0A7N9AZE8 | 1-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.