DPCstruct | MC53354
Metacluster Properties and Pfam Annotations
| Number of structural domains | 3 |
|---|---|
| Mean domain length (aa) | 262 ± 37 aa |
| Standard deviation of domain lengths | 36.75 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 29.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12925 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J3C785 | 9-237 | LSRDDDAEDDDYTDGDDSAWPRPESSPAPSTTTTTTTTTTTTASTATSDPYFSHFDPRTEHQSYKDAQQRLEETHREKITKVMKEWS… |
| W5JWC3 | 117-359 | PPAPAAAATKDQGSKKSSDAIGGPIGGLLYGGAGGYGSAPSTTEKSGSVELATTPITAIPTPDPYFTHFDPRNEHQSFKEAQQRLEE… |
| A0A075AGY1 | 179-491 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.