DPCstruct | MC53352
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 272 ± 32 aa |
| Standard deviation of domain lengths | 31.93 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 25.66 |
| Pfam Score | 72.55 |
| Assigned Pfam label(s) | CL0125- CL0745- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y9ZZK3 | 1-236 | MSAKRAGSKQDDPEATYNKAAKAELSKNYDAAFRGYIDAATAYLALSRSAVDARSQTRLRSQASKALERAERIKAVKSGLTPVIRNP… |
| A0A183KBC7 | 1-254 | MANPHELEKDADWFKRLAVWEESRKQYRSAVFYYTEAAQALLNSLEAGSKTEGLLELAQNYNNKVKELKSKTVVEDTSIPNSHISKS… |
| A0A0S7E7X0 | 1-257 | None |
| A0A7J7WBV1 | 1-329 | None |
| D8LU45 | 107-387 | None |
| A0A821AX87 | 62-337 | None |
| A0A7G2CFM0 | 157-400 | None |
| A0A3P7G548 | 246-577 | None |
| A0A0D0DE26 | 30-260 | None |
| A0A7R9QQQ7 | 27-328 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.