DPCstruct | MC5335
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 104 ± 12 aa |
| Standard deviation of domain lengths | 12.09 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 50.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00057 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W1BYP9 | 8-83 | AALFACRSGACVRLDAYCDGEAQCADGSDEPAHCTVCNRTYYGRVGVAYALAVRSAPRAPFLCHLTFTAGGAAHGD |
| A0A1B0DLK1 | 35-127 | KNSETSTISSRKCRVTEFPCENGGCIPLSKYCDQKYDCSDRSDEPKLCTVCNRTLYGEVGKTYELDVRQPKELPFICDFNFTALGNE… |
| A0A182TUN1 | 95-206 | None |
| A0A182FFA5 | 161-264 | None |
| A0A182MMS6 | 98-210 | None |
| A0A6G0YKJ6 | 24-117 | None |
| A0A4Y2G885 | 1-120 | None |
| A0A6P5W7X9 | 22-126 | None |
| A0A182WHP4 | 20-108 | None |
| A0A7J7A840 | 10-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.