DPCstruct | MC53345
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 193 ± 27 aa |
| Standard deviation of domain lengths | 26.62 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 72.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 27.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V1WY84 | 10-183 | SDEIFSCPEGGDFLVCKTGTKFVGCCNGLNACEHGCFDENLLPAAIRGEFVGEIPGVSCGGSVPFWSGSEKESSFYGCCDSDPFQNV… |
| A0A1Y2EB63 | 9-160 | KLGLSCPNGGRFYICQDSDVRFLGCCDIDPCADGSGDCPSSSLYGASFNKDSYNNVDAQDCISPYGSSTWWTCQNAKPPFIGCCLNN… |
| A0A6A6A3V5 | 8-204 | None |
| W9JQX3 | 12-233 | None |
| Q2GLX7 | 1-206 | None |
| A0A178AR57 | 1-191 | None |
| A0A423XFV5 | 1-140 | None |
| A0A0C3D980 | 7-168 | None |
| A0A428UIX7 | 3-226 | None |
| G0RTV9 | 213-428 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.