DPCstruct | MC5334
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 377 ± 83 aa |
| Standard deviation of domain lengths | 83.02 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 72.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 19.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1GN25 | 22-314 | LIDWNLIEQINIQTTEEQQCPICLFPPIAAKLTRCGHVYCWPCILHYLALSDKTWRKCPICYEAVHSLDLKSTAIIQKSNFNVGNEI… |
| A0A1B0DLH5 | 44-386 | QCPICLYPPVAGKMTRCGHVYCWPCILHYLALSDKSWRKCPICYEPIYVADLKSAVANYHHEFKIDEVVTLKLMKRKKGSLSVTEAS… |
| F0Y788 | 2-299 | None |
| A0A813HAP2 | 6-341 | None |
| W6U198 | 330-608 | None |
| L0PGV7 | 37-316 | None |
| A0A421JGD4 | 126-523 | None |
| A0A158QG43 | 80-464 | None |
| A0A151T926 | 206-504 | None |
| A0A0P0VJJ5 | 3-353 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.