DPCstruct | MC5333
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 155 ± 12 aa |
| Standard deviation of domain lengths | 12.42 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 68.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 42.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06466 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P8H9H9 | 2-136 | AATSDSNTSNNTTSDPSKRPGNSHMTPSDFSRPVNLQRIAQKKEQVKSFTRRKKLEKLGVYSSCKAEESCKCNGWKNPNPPPTPPRL… |
| A0A1B0DIR4 | 4-173 | DFNAAQFSVVPKEEPPSPQSAFGGHESSSAASSEPTPGATPGAPSAGGAPSTETTRQSSLQKIMQRKRNVWQLPHSQKLAKLSMYSA… |
| A0A834FP15 | 1-172 | None |
| A0A6J3HZ28 | 39-195 | None |
| A0A834JN25 | 16-178 | None |
| A0A4Z2BL48 | 1-150 | None |
| B7PUT4 | 1-139 | None |
| A0A0N1ISX5 | 18-162 | None |
| A0A6L2Q016 | 393-570 | None |
| V5GCN7 | 1-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.