DPCstruct | MC53326
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 135 ± 9 aa |
| Standard deviation of domain lengths | 9.31 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 42.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M0AUI7 | 4-132 | DFSPFNVNVTTAQPSDDQLKKTSGSDSEWGIRVVIGGDGSWYNKPGVVGVGYLDSFNDDIDTPTFVFSEVYNGSEKGVAETISHEVG… |
| A0A2D7E5V1 | 1-130 | MIESQKQCQHVAETFLPFDMNVTTRDRGIAALAKSNVTDFTWGIRAANTQPTAGFNAGIGGIAYLNSFSSDQDTPIFTFNEGARDGG… |
| H5WUS2 | 2-144 | None |
| A0A519ZVX2 | 1-143 | None |
| R4Z431 | 193-307 | None |
| A0A7G9P3V0 | 151-292 | None |
| A0A518BV14 | 167-308 | None |
| A0A3M1QKE8 | 131-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.