DPCstruct | MC53324
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 154 ± 13 aa |
| Standard deviation of domain lengths | 13.32 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7YMW6 | 1-156 | MFADPIWTERLVRSTGAADANHLVADLKRHHKADGVLLVIHANKAAASYNLTFYAGVHPVYAAERIVCFSRYPDQTPICAASYAHEI… |
| A0A3C0ID83 | 87-250 | TIESGTGSGKERVDWVSVVLKTVGYKTPMDFYRWAVREKGCDNVLVLVMANQGGRSYAIPFSKGLDEEKYFLEGCMLYRTRASGDKL… |
| A0A7W3X5G3 | 231-364 | None |
| A0A357AQD0 | 222-383 | None |
| A0A1F8V845 | 315-474 | None |
| A0A357CWW1 | 275-424 | None |
| A0A2H0GV78 | 1-172 | None |
| R6W566 | 214-374 | None |
| A0A358WEB8 | 141-307 | None |
| A0A396KWM0 | 86-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.