DPCstruct | MC53321
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 117 ± 10 aa |
| Standard deviation of domain lengths | 10.14 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 35.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2L2U5P2 | 8-116 | NTTPEELSEVNVLLSETFLDAIMQFSQKHGIPLSSIDTVGFHGETIWLLSIPEEGQIKSALSMAEGCFISSRTGITTVTDFRVSDQA… |
| A0A421D3I9 | 85-199 | NMILHNSTSPEEIAEINVILGEAFAMAVEEFTTKHGIDKSSIDALGSHGLTIWHLPMPNENQVKTTLSMAEGAILAARTGITTVSDF… |
| A0A354VMU7 | 44-186 | None |
| A0A0V0R038 | 42-165 | None |
| A0A814VPK2 | 603-697 | None |
| A0A378A598 | 15-127 | None |
| A0A2V7S692 | 36-143 | None |
| C6HVP4 | 4-138 | None |
| A0A3A0CK12 | 341-452 | None |
| I0KVZ6 | 58-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.