DPCstruct | MC5332
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 70 ± 12 aa |
| Standard deviation of domain lengths | 11.74 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 71.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 59.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0073 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G0YFI3 | 3-69 | GKSFTITITVSTCPPQVATYNKAIKVTVDGPREPRSKSLKNVHIYIGNCVLFVFPVHQGPPHQFRGL |
| A0A1B0DI13 | 2-59 | RYRKSFTLTITVSTTPPQVTTYSKAIKVTVDGPREPRSKTSKNINFMLFSQCTLSLNI |
| A0A6L5CX78 | 28-91 | None |
| X5CT71 | 20-92 | None |
| A0A0M5J6E6 | 46-117 | None |
| A0A484B172 | 2-70 | None |
| A0A1B0AL17 | 29-98 | None |
| T1GTP0 | 1-69 | None |
| A0A1A9VIM0 | 5-72 | None |
| A0A1A9WCC0 | 40-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.