DPCstruct | MC53316
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 224 ± 46 aa |
| Standard deviation of domain lengths | 46.28 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 91.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 25.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0H2YIP1 | 1-220 | MTTAYNHLCTAFTRLSRFEHLSAIAGWDMQTMMPAKGNLARSEAMAELNVLQHQILTAPQIGEWLKQAEQELLDEQSIDELKLANLR… |
| A0A556QXL5 | 18-208 | MMSPYESFVEKFSHIRLLHQIKSLLAWDQETYMPAGAIDIRVKQLAYIAGLAHQEVTSSSYLDDLAQMIDIDTEQIKLEGLSLTAQS… |
| A0A090PJF8 | 1-247 | None |
| A0A4Q3VXI6 | 33-263 | None |
| A0A5S9MBC9 | 6-162 | None |
| Q4UKJ0 | 7-250 | None |
| A0A6D0M340 | 5-169 | None |
| A0A2A8MGG3 | 6-226 | None |
| A0A0G1UXL7 | 14-262 | None |
| A0A812S5M7 | 437-685 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.