DPCstruct | MC53302
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 107 ± 17 aa |
| Standard deviation of domain lengths | 17.16 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 36.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T4HFL0 | 21-119 | MGNFNDIDDDFSYTSAHEIGHEILKSYTSDSFYSYKHKGSSTLSETKPISEGGFNYPSSGEIDLMKYFNNEPYWKDFKRVVAEEKDV… |
| A0A4Q6YMR4 | 172-261 | KQIDNDFKLVSAHEFGHSVLMYVGGISLSWGHKGSTNPLFQNIKSSTPGYPMSGNLDLMKYYDKNKQKEEKFQRVNDSIAMEIDIKR… |
| A0A2W2B0S0 | 332-439 | None |
| A0A1B8ZYN9 | 128-221 | None |
| A0A0N1MI10 | 1-109 | None |
| A0A246GGT8 | 12-135 | None |
| A0A246G7E7 | 86-184 | None |
| A0A1A7KNX3 | 76-225 | None |
| A0A1A7KNQ9 | 34-124 | None |
| A0A809PQ90 | 115-237 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.