DPCstruct | MC5330
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 90 ± 7 aa |
| Standard deviation of domain lengths | 7.25 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 76.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 52.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183CHE8 | 18-105 | PVNCARFEANIFCKIRCQNCFRPRQEHSAAALGEAQMNRKISACGFLYVAPINLDFSQPSHEKKRWQRRWFTLYDDGELSYGLDSNPD |
| A0A1B0DH30 | 1-99 | MSRNDCRKFSANIFNVSKCSHCFRQREEHSLKALESNRSTRKVTKCGYLFVAPDWDFITNPLYRTKRWQRRWFVLYDDGDLTYSVDE… |
| A0A4U5LUF2 | 1-87 | None |
| A0A2M4CI06 | 2-91 | None |
| A0A6J0UIN1 | 1-87 | None |
| T1F8Z0 | 18-105 | None |
| A0A162NP58 | 1-77 | None |
| A0A4Z2GIZ6 | 1-101 | None |
| A0A6P5A8N1 | 1-105 | None |
| A0A6J8D344 | 5-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.