DPCstruct | MC533
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 94 ± 6 aa |
| Standard deviation of domain lengths | 5.64 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.64 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 33.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A554JDZ4 | 142-228 | YGQSPVELKVTKNLGQDDLYDRIDRVELAANNFITTQTEEIVTRKGITGQGRINETHLKVGQKTRKTILELGGTPPELLPTVEHIDK |
| R9JUB3 | 7-102 | LDVDDIHTKKGLEVGQKILDYMGSTELIANLFRISQTEEKLRKDEVDNAKTATSVHYSVGREVRTAIEKIGGTMPENLPTPEKSIQQ… |
| A0A378W0S6 | 106-205 | None |
| R9JJD2 | 1-96 | None |
| A0A1I5UHD4 | 69-157 | None |
| Q1NLV0 | 80-172 | None |
| A0A849R3D3 | 2-99 | None |
| A0A6M7XQP5 | 124-218 | None |
| A0A1H5ZWC5 | 56-145 | None |
| A0A2Z6G7K7 | 74-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.