DPCstruct | MC53296
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 127 ± 15 aa |
| Standard deviation of domain lengths | 15.22 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 92.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.28 |
| Pfam Score | 85.71 |
| Assigned Pfam label(s) | PF00384- CL0516 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W5YLG2 | 2-133 | ETFYRWYAQTPRTVTGFSQGINQASAGTDKCNSIINCHLATGRVGLPGAGPFSLTGQPNAMGGREVGGLANTLAAHMDYDSPGARDS… |
| F9QAY6 | 162-319 | MVERITGVKQKTFLQICEEIGKTSAPNKTMTHLYALGFTEHTIGSQNIRSMAMIQLLLGNMGMPGGGINALRGHSNVQGTTDMGLLP… |
| A0A7C1IWD4 | 559-658 | None |
| A0A6G3VSL2 | 5-140 | None |
| G7V5S0 | 948-1080 | None |
| A0A447X7V0 | 2-96 | None |
| I2BBY0 | 266-385 | None |
| A0A0K2RSR9 | 113-224 | None |
| A0A1V5JGA5 | 11-127 | None |
| A0A2X2C2Z5 | 2-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.