DPCstruct | MC53295
Metacluster Properties and Pfam Annotations
| Number of structural domains | 197 |
|---|---|
| Mean domain length (aa) | 143 ± 20 aa |
| Standard deviation of domain lengths | 20.03 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 19.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0131 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R6JNI7 | 24-144 | EVVMDVVVLIGRILFAALFAVSAIGHFGKTDAMTGYAKSRGVPAARLAVLGGGVLLVLGTVSVLLGIWPDLGALLLVVFLVPTALLM… |
| A0A0S4LU88 | 3-132 | DRYISLVGRLLLGMIFVISGFRKVADPGGTQVFMEAMGIAWATTFFYLSAIAIELVGGVSLLLGLWSRIGAALLALFMIPTTLIFHA… |
| A0A267TBE6 | 4-160 | None |
| A0A534P0Q9 | 2-128 | None |
| A0A257ZKX3 | 12-140 | None |
| A0A1I0RUJ7 | 14-160 | None |
| A0A522CFM5 | 12-165 | None |
| A0A428W7K9 | 5-168 | None |
| A0A7Y0Q0M1 | 3-174 | None |
| V2JWP0 | 2-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.