DPCstruct | MC5329
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 276 ± 27 aa |
| Standard deviation of domain lengths | 27.09 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 20.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05334 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T7PMR8 | 275-520 | KLDEEFKEALKINFGALFEDNQGFAHLEALEMLSNQSERKVQSLLSHMADDDLELVRPHLVEIKDVFQQLGEVQEKETADELEHDFS… |
| A0A1B0DGY7 | 1-241 | MKQMHKHLYRKQLHFETLFDDYCGLVHLEALEILSKQCVLKLQSLLAPLTGKALQEMQETIGEVKELCELPEMEADDADGMHTVEEL… |
| A0A6H5I9M9 | 564-811 | None |
| A0A0B2VHB2 | 345-571 | None |
| A0A453HC02 | 9-311 | None |
| A0A2P5WZI7 | 41-323 | None |
| A0A6P8TTJ7 | 269-573 | None |
| A0A820TYV4 | 2-273 | None |
| A0A672T9M3 | 93-395 | None |
| A0A7S4HR04 | 436-722 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.