DPCstruct | MC53286
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 135 ± 17 aa |
| Standard deviation of domain lengths | 16.63 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 36.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0169 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N8K860 | 1-141 | ADWWKRKLWLLRCEWREEQLRAACLVSRKTSPYLSQDALSEFRAQREKTRDFLKSFMLENEDGFTIDLETVYYAGVSNPVHRKAEMM… |
| G7EFG5 | 55-194 | NRWWLRKFRKLITQANEKAALHLNFVNRKREIYASNITTQNRITQRQRNDELLSSTYILNEQGQRYSLKEISDLNVSNPKIRKDELL… |
| A0A1I2GWH5 | 130-282 | None |
| A0A192CND0 | 68-195 | None |
| A0A090T0S2 | 67-232 | None |
| A0A495QHB5 | 121-256 | None |
| A0A1B8NUN3 | 89-211 | None |
| A0A1W9F725 | 80-190 | None |
| A0A4P0YQA3 | 267-429 | None |
| A0A838ZWG5 | 103-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.