DPCstruct | MC5328
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 96 ± 7 aa |
| Standard deviation of domain lengths | 6.64 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 78.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 53.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0144 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D2N0H3 | 516-609 | VIYLFHSNEGLLRLQSIFEKQGFKNESLRVRVMKRISSVMDALSIIRNLEVAQRFQPKHIILDCPASLAKDIIISHVRDLHLGRRTY… |
| A0A6J1NDD0 | 150-243 | VIFLYDSNDGLLRLEQVYKHLSPGQAMFQITHTRRVSSALDVITFLVGLENLNRWTNKYVVLDCGTPLAKEVLVHHVRNVTLGRRNY… |
| A0A7R9EBP5 | 3-89 | None |
| A0A182WKI8 | 1-99 | None |
| A0A6L5D6H1 | 65-163 | None |
| A0A7R9D421 | 5-114 | None |
| A0A226DFK9 | 7-95 | None |
| A0A1B0GL55 | 52-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.