DPCstruct | MC53278
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 71 ± 14 aa |
| Standard deviation of domain lengths | 14.12 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 88.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 46.91 |
| Pfam Score | 98.15 |
| Assigned Pfam label(s) | CL0137- CL0255 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M1DPV0 | 21-90 | LAVETNNLQNWKTMGGNDSKSAVEYKSSKRMEWVKDGYRIGNIGDQWTDLIGENVGARTFKVPNPMYYVG |
| O82122 | 183-262 | WKLWKNVTLDNLEAAGVTYWKHLILKPNGSNLRQVVYKSKVRKSLVKKGYNIVGNIGDQWADLVEDTPGRVFKLPNPLYY |
| A0A4S4EAQ2 | 799-892 | None |
| A0A4S4DRC5 | 348-437 | None |
| A0A1E5UPR7 | 166-257 | None |
| A0A0K9RV90 | 215-269 | None |
| A0A0A8XXU1 | 1-49 | None |
| A0A2G3CR55 | 83-139 | None |
| A0A6P5H9N9 | 319-403 | None |
| T1MBJ8 | 19-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.