DPCstruct | MC53277
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 153 ± 13 aa |
| Standard deviation of domain lengths | 12.73 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 72.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 41.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M1DPF4 | 1-161 | MPTASTDIWNIEDEYLKDQAERKKAAAMELVNTESSPAKASLPAPAHGPSGTSIATVTPADTPGSFAAAQSPRPTTVVVISRLSLTR… |
| M1DC51 | 1-146 | MPTTSTNIQKIEAEYLKDQAEKKQTEVATTRSTPTKELLLTPALGPSGISITTATSTNTPGSFAAISRPLLTHASLLRMGQMALFVD… |
| M1DN86 | 96-256 | None |
| M1DLH4 | 41-185 | None |
| M1DK12 | 1-146 | None |
| M1DJC5 | 92-271 | None |
| M1DIK7 | 373-523 | None |
| M1DF28 | 104-271 | None |
| M1DCJ3 | 1-163 | None |
| M1DHT0 | 57-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.