DPCstruct | MC53276
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 119 ± 19 aa |
| Standard deviation of domain lengths | 19.30 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 65.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 45.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M1DNP1 | 142-228 | DGVVDCYPEVWSTLKFYQFEIFTKPRGPYIPTWFWEFYSAYGELVPKGKKKANAFKTIDHVMLWGRKVKCSSSDINEILKCSREFKH |
| M1DGI6 | 1-102 | MDGVIDQYPDICRTIKARKFEIFTKPRCSYIPSWVREFYAAYGALMPQRKRNAAIFKPIDYVVVRGKKVKCDGIWINEQSKDSKRQK… |
| M1DEY5 | 8-129 | None |
| M1DHU1 | 20-144 | None |
| M1DZD5 | 203-305 | None |
| M1DWJ0 | 74-216 | None |
| M1DT06 | 73-213 | None |
| M1DRP2 | 455-595 | None |
| M1DY02 | 58-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.