DPCstruct | MC53271
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 101 ± 14 aa |
| Standard deviation of domain lengths | 13.63 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 47.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M1D4Y2 | 20-111 | MICWERKSSKIFLQRLDKSGGYKSKLEYATYFSEVVAEGILKEKEDFVPQLAELIKLGFILKFDEAAIEFLMKTENLQIFLEDEEFL… |
| A0A3L6PKK4 | 92-200 | SVSLSSGEVVNVKVNRMLRWERENSKLYMQSSNGESSYKEKIEFATYFAEEISKGLLFEMPDQIPYLSELIKFGSLLDFDDAVVAFL… |
| A0A6S7N6F6 | 137-228 | None |
| A0A7J7NBL6 | 270-365 | None |
| A0A7C9AQ70 | 158-268 | None |
| A0A0A9URW8 | 1-98 | None |
| A0A6S7NFR1 | 280-369 | None |
| A0A2P6P4M7 | 365-452 | None |
| R7W496 | 1030-1138 | None |
| A0A0R0IP06 | 274-364 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.