DPCstruct | MC5327
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 77 ± 12 aa |
| Standard deviation of domain lengths | 11.93 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 60.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A1ZD09 | 142-201 | GSTKGTNALLENKGAKIVFFVTKGFKDLLKIGTQQRPDIFAMRVEKPAPLHYKVVEVEER |
| A0A1B0DFJ1 | 1-77 | MGTTVATNALLERKGDPVALVVNRGFRDLLYIGNQARPSIFALDIRKPSNLYKTVIEVDCKVIPDQPDKCQLKHAPF |
| A0A368FV55 | 34-121 | None |
| S9XX98 | 215-298 | None |
| F3NJY9 | 75-138 | None |
| A0A1I8ILW1 | 555-643 | None |
| A0A368F500 | 34-123 | None |
| A0A832TZ51 | 58-116 | None |
| A0A0K0DEW8 | 1-87 | None |
| A0A2G9TNY0 | 75-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.