DPCstruct | MC53269
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 119 ± 6 aa |
| Standard deviation of domain lengths | 5.78 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 75.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 33.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C9AEA7 | 77-189 | PSSYLNKILKRHGRVTVKNYGSVYETSCQDLQLSVGSEFMFGSQDENMLRFIVFNACSSTNWSVIGHAMHSNTINELGKYLMEEQMN… |
| M1D417 | 1-110 | MKRHGTVTVRNQASTFDSSCQDLVFSAQSKKIISSLDRDFFQSLILKACCSTPLTVVGSLVNSDAIRQLETHLTELDIVMLPMQNVW… |
| A0A484KU97 | 515-634 | None |
| A0A287RE59 | 318-431 | None |
| A0A2G9H138 | 279-401 | None |
| A0A4S8J8Y5 | 101-223 | None |
| A0A328DNP0 | 37-154 | None |
| D0EL35 | 1144-1272 | None |
| A0A2T8KQ96 | 85-200 | None |
| A0A6A4QTT5 | 181-299 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.