DPCstruct | MC5326
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 213 ± 30 aa |
| Standard deviation of domain lengths | 30.02 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 76.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 21.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L5C6S7 | 46-233 | SKHAPCNGMVHLLRPNSILFDDDVVRKLVTESCGVFQNLQQIKKEAKEKGQDPLPEILKISRRYRCIVRACVADLQEVAMDEKTSEE… |
| A0A1B0DDQ1 | 4-211 | PDCIYTIFDNKCKAAGITGTWVTPDTLSVTAFRPVLSNTRDQVSKYVSKDSTNIYHLKFPFIFSEPILTDFVGETCAIFRTLRTIKS… |
| A0A3R7PX47 | 3-248 | None |
| A0A0M3IZF1 | 1-206 | None |
| A0A6G0WRD9 | 1-181 | None |
| A0A6J8B2D4 | 11-242 | None |
| A0A4Y9ZF21 | 1-226 | None |
| A0A061R9W4 | 10-289 | None |
| A0A1I8FET3 | 15-263 | None |
| A0A3R6YV78 | 237-447 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.