DPCstruct | MC53251
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 287 ± 39 aa |
| Standard deviation of domain lengths | 38.94 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 16.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V9MUX7 | 18-273 | AEDPGQPQVNSRIGDGFNLDGKIKAGDFVSPDGEKGIDNNLYRAWGCDAPWRGNGNATLDLRANDKMQEGLYTMVVRLSGNKDPMND… |
| A0A2W5NXU1 | 109-374 | NVYIHPETTPDGGLVGVAGTVGEGLDLDGDPATGGFVSLKGQKGVDNAFYRALGCWKTYRGPPRLSTGALQFNDAMRDGAWTVVVVL… |
| A0A519FMF9 | 254-516 | None |
| A0A1F9N7Y7 | 235-549 | None |
| A0A7V9MVA9 | 151-396 | None |
| A0A7Y2EQF9 | 31-314 | None |
| A0A2E0Z4A5 | 82-371 | None |
| A0A0S8G1V8 | 12-330 | None |
| A0A4U1HKQ5 | 278-592 | None |
| A0A2D5QM71 | 66-375 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.