DPCstruct | MC5325
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 64 ± 3 aa |
| Standard deviation of domain lengths | 3.16 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 90.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 54.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A674KCM5 | 27-90 | PRIVEHPSDLIVSKGEPATLNCKAEGRPTPTIEWYKGGERVETDKDDPRSHRMLLPSGSLFFLR |
| A0A1B0DD84 | 2-61 | RPRILEHPADAVAAREEPLTLNCKAAGRPTPEITWFHNGTPLVPSERRVVLPEGSLFFLR |
| A0A0P7VAB5 | 272-335 | None |
| A0A7R9ECE1 | 24-87 | None |
| A0A6P8KPZ8 | 23-83 | None |
| A0A183HBN8 | 1-65 | None |
| A0A6G0ZHA7 | 6-69 | None |
| A0A667Z7U3 | 19-90 | None |
| B7QEN0 | 275-333 | None |
| A0A482X9H4 | 13-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.