DPCstruct | MC53243
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 80 ± 5 aa |
| Standard deviation of domain lengths | 5.25 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 62.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A383UMU9 | 1-82 | MAARQPQFNQTVLIDTAPLPADIPPVKEVGSSSAPLMSASFFIGARCKPYNDDFMQCKTENPGKGEFNCLKEGRKVSRCARS |
| A0A5Q7YH61 | 1-65 | MPSDVPDVEEVGATSAPLLSAAFFIGARCKPYNDDFMMCKDEKNGGTVECLKEGRRVTRCAVSVL |
| A0A421JK82 | 105-182 | None |
| A0A261Y3H1 | 2-83 | None |
| A0A5N6KSG4 | 52-124 | None |
| A0A6A6UIL3 | 3-86 | None |
| A0A0W4ZNT1 | 3-87 | None |
| A0A3M7LY16 | 2-78 | None |
| A0A167BHB5 | 1-84 | None |
| I2JYZ5 | 15-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.