DPCstruct | MC5323
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 148 ± 11 aa |
| Standard deviation of domain lengths | 10.78 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 68.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.29 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 40.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A448WE85 | 13-168 | WQRKYNAPRESYCKNSSEVTDQPFGIEVRNVRCMRCKQWGHMNTDRVCPLFGQSFTQEPTPDDVLPLDHAKASLRQEGLEFKKATNV… |
| A0A1B0DBQ6 | 5-142 | KILRDQPFGIQVRNVRCIKCHKWGHINTDKECTMYSISMSEARKIHSEQEAQSIMAKGVLEEQMKEDGLAMRKSAMSLQSFQSGRLH… |
| A0A670XM67 | 99-255 | None |
| A0A6P7W0U5 | 88-231 | None |
| A0A7I8VS02 | 88-231 | None |
| A0A0N4W017 | 1-146 | None |
| A0A7R9KRY4 | 88-222 | None |
| F2UF92 | 41-188 | None |
| A0A814ZY88 | 67-197 | None |
| A0A401P668 | 100-248 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.